TD3B: Transition-Directed Discrete Diffusion for Allosteric Binder Generation

arXiv
![Screenshot 2026-05-10 at 6.52.29 PM](https://cdn-uploads.huggingface.co/production/uploads/64cd5b3f0494187a9e8b7c69/38-6PQ83pPraF7KAs3g3E.png) TD3B is a sequence-based generative framework that designs peptide binders with specified agonist or antagonist behavior. It combines a Direction Oracle, a soft binding-affinity gate, and amortized fine-tuning of a pre-trained discrete diffusion model (MDLM). > **Development release.** This repository (`ChatterjeeLab/TD3B-dev`) carries the full code. The heavy artifacts — trained checkpoints, training/test data, and generated binders — are distributed as a single archive on Google Drive (see [Data and Checkpoints](#data-and-checkpoints)). For the clean code-only release see [`ChatterjeeLab/TD3B`](https://huggingface.co/ChatterjeeLab/TD3B). ## Installation ```bash conda env create -f env.yml conda activate td3b pip install -e . ``` ## Demo An interactive inference demo is provided in [`notebooks/TD3B_Inference_Demo.ipynb`](notebooks/TD3B_Inference_Demo.ipynb) (configured for a Colab T4 GPU). [![Open In Colab](https://colab.research.google.com/assets/colab-badge.svg)](https://colab.research.google.com/) To run it: download the notebook from this repository, open [Google Colab](https://colab.research.google.com/), upload it via **File → Upload notebook**, and select a GPU runtime (**Runtime → Change runtime type → T4 GPU**). ## Data and Checkpoints The checkpoints, datasets, and generated binders are bundled in a single archive on Google Drive: **Download:** [`td3b_dev_artifacts.zip`](https://drive.google.com/file/d/1EU0-pcF-UoEb0OEMuO4qhodZ5RjMU4n9/view?usp=sharing) (~3.4 GB) Unzip it at the repository root to restore the full layout: ```bash unzip td3b_dev_artifacts.zip -d . ``` ``` TD3B-dev/ ├── checkpoints/ │ ├── pretrained.ckpt # Pre-trained MDLM weights (1.4 GB) │ ├── td3b.ckpt # Fine-tuned TD3B model (231 MB) │ └── direction_oracle.pt # Direction Oracle weights (2.85 GB) ├── scoring/functions/classifiers/ │ ├── binding-affinity.pt # (from archive) │ ├── permeability-xgboost.json # (from archive) │ ├── hemolysis-xgboost.json # (in repo) │ ├── nonfouling-xgboost.json # (in repo) │ └── solubility-xgboost.json # (in repo) ├── data/ │ ├── train.csv # Training set (target-binder pairs) │ ├── test.csv # Test set │ └── td3b_data_new.csv # Full labeled target/ligand pairs (agonist/antagonist) └── generated_binders/ ├── agonist/ # 1106 generated agonist binders (.pdb + .trb), 249 targets └── antagonist.tar.gz # Generated antagonist binders ``` ## Code Structure ``` TD3B/ ├── inference.py # Generate binders (main inference entry point) ├── finetune_on_target.py # Finetune on your own target(s) + generate (Function A) ├── generate_valid.py # Validity-boosting sampling CLI (Function B) ├── sampling_strategies.py # Validity-boosting sampler library (Function B) ├── finetune_multi_target.py # Multi-target TD3B training ├── launch_multi_target.sh # Training launcher script ├── models/ │ ├── diffusion.py # MDLM backbone (TR2-D2) │ ├── roformer.py # RoFormer wrapper │ └── noise_schedule.py # Noise schedules ├── training/ │ ├── finetune_utils.py # Training utilities │ └── distributed_utils.py # Distributed training helpers ├── mcts/ │ └── peptide_mcts.py # MCTS tree search ├── td3b/ │ ├── direction_oracle.py # Direction Oracle (f_φ) │ ├── td3b_scoring.py # Gated reward R = g_ψ · σ(d*·(f_φ−0.5)/τ) │ ├── td3b_losses.py # L_WDCE + λ·L_ctr + β·L_KL │ ├── td3b_mcts.py # TD3B-extended MCTS │ ├── td3b_finetune.py # Training loop │ └── data_utils.py # Data loading utilities ├── scoring/ # Affinity predictor (g_ψ) and property classifiers ├── baselines/ # CG, SMC, TDS, PepTune, Unguided baselines ├── tokenizer/ # SMILES tokenizer (vocab + splits) ├── configs/ # Model and training configs └── utils/ # Misc utilities ``` ## Inference Generate agonist/antagonist binders for target proteins: ```bash python inference.py \ --ckpt_path checkpoints/td3b.ckpt \ --val_csv data/test.csv \ --save_path results/ \ --seed 42 \ --num_pool 32 \ --val_samples_per_target 8 \ --resample_alpha 0.1 ``` This generates 32 candidates per (target, direction), scores them with the Direction Oracle and affinity predictor, applies Algorithm 2 weighted resampling, and saves only valid peptide samples. > **Generation length matters.** The length (in SMILES tokens) comes from `--seq_length` if given, else it is > derived from each row's reference binder (correctly tokenized). This released checkpoint reliably produces > **valid** SMILES only at **short lengths (≲100 tokens)**; long binders (e.g. 25–30-residue peptides ≈ 150–210 > tokens) yield few or no valid samples regardless of step count. For non-empty output on such targets, pass a > shorter `--seq_length` and a validity-boosting sampler (see below), e.g.: > ```bash > python inference.py --ckpt_path checkpoints/td3b.ckpt --val_csv data/test.csv \ > --seq_length 50 --sampler best_of_n --best_of_n 6 --num_pool 32 --val_samples_per_target 4 > ``` > On a real run this yields valid, oracle-scored binders in both directions (antagonist direction accuracy ≈ 1.0). Output: `results/td3b_results_seed42.csv` with columns: target, target_uid, sequence, direction_name, target_direction, is_valid, affinity, gated_reward, direction_oracle, direction_accuracy. ## Finetune on your own target(s) `finetune_on_target.py` takes protein target(s) you supply, finetunes the pretrained TD3B policy on **only those target(s)**, then generates directional (agonist/antagonist) binders for them. It reuses the existing machinery: the finetune half subprocess-invokes `finetune_multi_target.py` (with `K` set to the number of targets), and the generation half runs in-process with the same reward, oracle, and Algorithm 2 resampling as `inference.py`. ```bash python finetune_on_target.py \ --target_seq MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQ \ --target_seq GSHMKELVLALYDYQEKSPREVTMKKGDILTLL \ --direction both \ --validity_reward on \ --num_epochs 20 \ --num_pool 32 \ --gen_samples_per_target 8 \ --device cuda:0 --seed 42 ``` Provide targets by repeating `--target_seq` and/or via `--targets_csv` (a CSV with a `Target_Sequence` column; optional `Ligand_Sequence`/`label` rows seed the per-direction length prior): ```bash python finetune_on_target.py --targets_csv my_targets.csv --direction agonist --binder_length 20 ``` Key flags: - `--target_seq SEQ` (repeatable) and/or `--targets_csv` — provide at least one target. - `--direction {agonist,antagonist,both}` (default `both`) — which binders to **generate**. Finetuning always searches both directions. - `--validity_reward {on,off}` (default `on`) — validity gate applied to **both** halves. `on` keeps the `is_peptide` filter (invalid MCTS children are zero-rewarded during finetuning; only valid peptides are eligible for resampling during generation). `off` drops the gate on both halves (invalid samples are retained, each row keeps `is_valid`); the reward itself is always affinity × direction — validity is only ever a filter, never part of the reward formula. `--finetune_validity_hook {on,off}` overrides just the finetune-side gate. - `--binder_length` (default 20) — placeholder binder length (residues) used to seed the generation-length prior for any target with no known binder. - `--skip_finetune` (generate directly from `--td3b_checkpoint`) / `--skip_generate` (finetune only). - Training knobs: `--num_epochs` (20), `--num_iter` (10) / `--num_children` (16) (MCTS), `--learning_rate` (3e-4), `--seq_length` (200). Generation knobs: `--num_pool` (32), `--gen_samples_per_target` (8), `--resample_alpha` (0.1), `--total_num_steps` (128). - Paths default to the repo root; override `--pretrained_checkpoint`, `--direction_oracle_ckpt`, `--output_dir`, `--device` (`auto`/`cpu`/`cuda:N`), `--seed` as needed. Output: `results/finetune_on_target/binders__validity-_seed.csv` with columns target, sequence, direction_name, target_direction, is_valid, affinity, gated_reward, direction_oracle, direction_accuracy, gen_length. The finetuned checkpoint is written under `results/_/` (used automatically for the generation half). ## Higher-validity sampling for long binders As the target length grows, the fraction of decoded SMILES that pass the RDKit peptide check drops. `generate_valid.py` (backed by `sampling_strategies.py`) applies **sampling-time** strategies — no retraining — to raise the valid-peptide yield, especially at large length, and reports the valid fraction. The strategies only change token selection (temperature / top-k / top-p) and add a remask self-correction loop and best-of-N rejection on top of the model's existing diffusion primitives. ```bash python generate_valid.py \ --ckpt_path checkpoints/td3b.ckpt \ --length 400 --num_samples 64 \ --strategy nucleus_remask \ --device cuda:0 --seed 42 \ --save_path results/valid_len400.csv ``` Key flags: - `--strategy` (default `nucleus_remask`) — one of `baseline`, `more_steps`, `top_p` (a.k.a. `nucleus`), `top_k`, `low_temp`, `remask`, `best_of_n`, `nucleus_remask`. On random-init benchmarks the self-correcting strategies (`remask`, `best_of_n`, `nucleus_remask`) give the largest relative validity gains at length ≥ 200; `nucleus_remask` is the recommended default. - `--length` (default 200, in tokens) and `--num_samples` (default 64). - `--ckpt_path` — TD3B checkpoint. If omitted or missing, a **random-init** model is used (exercises the sampling machinery only; yields are meaningless — pass a real checkpoint for real numbers). - Per-strategy overrides (else the preset default is used): `--top_p`, `--top_k`, `--temperature`, `--steps_per_token`, `--remask_rounds`, `--remask_frac`, `--remask_steps`, `--best_of_n`, `--num_steps`. Output: prints the valid yield (valid / `num_samples`) with per-round counts, and writes the valid sequences to `--save_path` (default `results/valid__len.csv`) with columns idx, sequence, n_chars. ### Binding-affinity backends The original TD3B affinity predictor remains the default. To use PeptiVerse's pooled target-sequence/binder-SMILES regressor instead, add: ```bash python inference.py \ --ckpt_path checkpoints/td3b.ckpt \ --val_csv data/test.csv \ --affinity_backend peptiverse ``` The PeptiVerse checkpoint and its ESM-2/ChemBERTa encoders are downloaded from Hugging Face on first use. For offline runs, provide `--peptiverse_affinity_checkpoint /path/to/best_model.pt` together with `--peptiverse_local_files_only`. Training supports the same flags; alternatively, set `AFFINITY_BACKEND="peptiverse"` in `launch_multi_target.sh`. ## Training ### Multi-target TD3B 1. Edit `launch_multi_target.sh` only if needed — `BASE_PATH` auto-detects the repo root (this script's own directory), and the checkpoint, data, and oracle paths derive from it: ```bash BASE_PATH="$(cd "$(dirname "${BASH_SOURCE[0]}")" && pwd)" # auto-detects the repo root PRETRAINED_CHECKPOINT="${BASE_PATH}/checkpoints/pretrained.ckpt" TRAIN_CSV="${BASE_PATH}/data/train.csv" ORACLE_CKPT="${BASE_PATH}/checkpoints/direction_oracle.pt" ``` `finetune_multi_target.py --base_path` also defaults to the repo root, so you only need to override these when your checkpoints or data live elsewhere. 2. Launch training: ```bash bash launch_multi_target.sh ``` Key hyperparameters (in `launch_multi_target.sh`): - `CONTRASTIVE_WEIGHT=0.1` — λ for L_ctr - `KL_BETA=0.1` — β for L_KL - `SIGMOID_TEMPERATURE=0.1` — τ for gated reward - `NUM_ITER=20` — MCTS iterations per round - `NUM_CHILDREN=16` — Children per MCTS expansion ### Baselines Run baseline methods (CG, SMC, TDS, PepTune, Unguided): ```bash cd baselines/ bash run.sh --baseline cg --device cuda:0 bash run.sh --baseline smc --device cuda:0 bash run.sh --baseline tds --device cuda:0 ``` ## Citation ```bibtex @inproceedings{ cao2026tdb, title={{TD}3B: Transition-Directed Discrete Diffusion for Allosteric Binder Generation}, author={Hanqun Cao and Aastha Pal and Sophia Tang and Yinuo Zhang and Jingjie Zhang and Pheng-Ann Heng and Pranam Chatterjee}, booktitle={Learning Meaningful Representations of Life (LMRL) Workshop at ICLR 2026}, year={2026}, url={https://openreview.net/forum?id=uMUicLylVp} } ```